SCOPe 2.05: Domain d3ik3a_: 3ik3 A:

Lineage for d3ik3a_ (3ik3 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (12 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187169] (35 PDB entries)

8. Domain d3ik3a_: 3ik3 A: [178360]
   automated match to d1opjb_
   complexed with 0li; mutant

Details for d3ik3a_

PDB Entry: 3ik3, 1.9 Å

PDB Description: ap24534, a pan-bcr-abl inhibitor for chronic myeloid leukemia, potently inhibits the t315i mutant and overcomes mutation-based resistance

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d3ik3a_:

Sequence, based on SEQRES records:

>d3ik3a_ d.144.1.7 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
avmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevsavvllymatqi
ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkr

Sequence, based on observed residues (ATOM records):

>d3ik3a_ d.144.1.7 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
avmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevsavvllymatqi
ssameylekknfihrdlaarnclvgenhlvkvadfglstytahagakfpikwtapeslay
nkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmr
acwqwnpsdrpsfaeihqafetmfqessisdevekelgkr

Timeline for d3ik3a_:

• d3ik3a_ first appeared in SCOPe 2.01
  
• d3ik3a_ appears in SCOPe 2.04
  
• d3ik3a_ is called d3ik3a1 in SCOPe 2.06
  
• d3ik3a_ appears in the current release, SCOPe 2.08, called d3ik3a1