Lineage for d3ik3a1 (3ik3 A:229-513)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2979723Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
    PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase
  7. 2979737Species Mouse (Mus musculus) [TaxId:10090] [56167] (16 PDB entries)
  8. 2979743Domain d3ik3a1: 3ik3 A:229-513 [178360]
    Other proteins in same PDB: d3ik3a2, d3ik3b2
    automated match to d1opjb_
    complexed with 0li; mutant

Details for d3ik3a1

PDB Entry: 3ik3 (more details), 1.9 Å

PDB Description: ap24534, a pan-bcr-abl inhibitor for chronic myeloid leukemia, potently inhibits the t315i mutant and overcomes mutation-based resistance
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d3ik3a1:

Sequence, based on SEQRES records: (download)

>d3ik3a1 d.144.1.7 (A:229-513) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa
vmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevsavvllymatqis
sameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtap
eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv
yelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkr

Sequence, based on observed residues (ATOM records): (download)

>d3ik3a1 d.144.1.7 (A:229-513) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa
vmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevsavvllymatqis
sameylekknfihrdlaarnclvgenhlvkvadfglstytahagakfpikwtapeslayn
kfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmra
cwqwnpsdrpsfaeihqafetmfqessisdevekelgkr

SCOPe Domain Coordinates for d3ik3a1:

Click to download the PDB-style file with coordinates for d3ik3a1.
(The format of our PDB-style files is described here.)

Timeline for d3ik3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ik3a2