Lineage for d3ijwa1 (3ijw A:1-264)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2530622Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest
  4. 2530623Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) (S)
  5. 2530639Family c.140.1.0: automated matches [191555] (1 protein)
    not a true family
  6. 2530640Protein automated matches [190957] (7 species)
    not a true protein
  7. 2530654Species Bacillus anthracis [TaxId:198094] [189077] (3 PDB entries)
  8. 2530655Domain d3ijwa1: 3ijw A:1-264 [178352]
    Other proteins in same PDB: d3ijwa2
    automated match to d2nyga1
    complexed with aco, cl, mg

Details for d3ijwa1

PDB Entry: 3ijw (more details), 1.9 Å

PDB Description: crystal structure of ba2930 in complex with coa
PDB Compounds: (A:) Aminoglycoside N3-acetyltransferase

SCOPe Domain Sequences for d3ijwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ijwa1 c.140.1.0 (A:1-264) automated matches {Bacillus anthracis [TaxId: 198094]}
mndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmevit
eegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfrty
pnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgydsnt
svhlsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtmgki
gnakcrlmkqrdivdfgtewfrkk

SCOPe Domain Coordinates for d3ijwa1:

Click to download the PDB-style file with coordinates for d3ijwa1.
(The format of our PDB-style files is described here.)

Timeline for d3ijwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ijwa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3ijwb_