SCOPe 2.05: Domain d3ijwa_: 3ijw A:

Lineage for d3ijwa_ (3ijw A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest

4. Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families)

5. Family c.140.1.0: automated matches [191555] (1 protein)
   not a true family

6. Protein automated matches [190957] (3 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [189077] (3 PDB entries)

8. Domain d3ijwa_: 3ijw A: [178352]
   automated match to d2nyga1
   complexed with aco, cl, mg

Details for d3ijwa_

PDB Entry: 3ijw, 1.9 Å

PDB Description: crystal structure of ba2930 in complex with coa

PDB Compounds: (A:) Aminoglycoside N3-acetyltransferase

SCOPe Domain Sequences for d3ijwa_:

Sequence; same for both SEQRES and ATOM records:

>d3ijwa_ c.140.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 198094]}
amndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmevi
teegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfrt
ypnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgydsn
tsvhlsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtmgk
ignakcrlmkqrdivdfgtewfrkk

Timeline for d3ijwa_:

• d3ijwa_ first appeared in SCOPe 2.01
  
• d3ijwa_ appears in SCOPe 2.04
  
• d3ijwa_ is called d3ijwa1 in SCOPe 2.06
  
• d3ijwa_ appears in the current release, SCOPe 2.08, called d3ijwa1