| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest |
Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) ![]() |
| Family c.140.1.0: automated matches [191555] (1 protein) not a true family |
| Protein automated matches [190957] (2 species) not a true protein |
| Species Bacillus anthracis [TaxId:198094] [189077] (2 PDB entries) |
| Domain d3ijwa_: 3ijw A: [178352] automated match to d2nyga1 complexed with aco, cl, mg |
PDB Entry: 3ijw (more details), 1.9 Å
SCOPe Domain Sequences for d3ijwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ijwa_ c.140.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 198094]}
amndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmevi
teegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfrt
ypnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgydsn
tsvhlsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtmgk
ignakcrlmkqrdivdfgtewfrkk
Timeline for d3ijwa_: