| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
| Family d.129.3.9: Smu440-like [160747] (1 protein) PfamB PB094079 |
| Protein Hypothetical protein SMU440 [160748] (1 species) |
| Species Streptococcus mutans [TaxId:1309] [160749] (2 PDB entries) Uniprot Q8DVN6 1-137 |
| Domain d3ijtb1: 3ijt B:1-137 [178351] Other proteins in same PDB: d3ijta2, d3ijtb2 automated match to d3ijta_ |
PDB Entry: 3ijt (more details), 2.38 Å
SCOPe Domain Sequences for d3ijtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ijtb1 d.129.3.9 (B:1-137) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]}
mkfsfelavntkkedawtyysqvnqwfvwegdleqislegefttgqkgkmkmedmpelaf
tlvevrenqcfsdltatpfgnvlfeheilenpdgtislrhsvsltdsdtteealaflkqi
fadvpesvgklkqilet
Timeline for d3ijtb1: