Lineage for d3ijtb_ (3ijt B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.129: TBP-like [55944] (11 superfamilies)
beta-alpha-beta(4)-alphaSuperfamily d.129.3: Bet v1-like [55961] (11 families) 
contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
Family d.129.3.9: Smu440-like [160747] (1 protein)
PfamB PB094079Protein Hypothetical protein SMU440 [160748] (1 species) Species Streptococcus mutans [TaxId:1309] [160749] (1 PDB entry)
Uniprot Q8DVN6 1-137
Domain d3ijtb_: 3ijt B: [178351]
automated match to d3ijta_
Details for d3ijtb_
PDB Entry: 3ijt (more details), 2.38 Å
PDB Description: structural characterization of smu.440, a hypothetical protein from streptococcus mutans
PDB Compounds: (B:) Putative uncharacterized proteinSCOPe Domain Sequences for d3ijtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ijtb_ d.129.3.9 (B:) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]}
qmgrgsmkfsfelavntkkedawtyysqvnqwfvwegdleqislegefttgqkgkmkmed
mpelaftlvevrenqcfsdltatpfgnvlfeheilenpdgtislrhsvsltdsdtteeal
aflkqifadvpesvgklkqilet
SCOPe Domain Coordinates for d3ijtb_:
Click to download the PDB-style file with coordinates for d3ijtb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ijtb_:
- d3ijtb_ first appeared in SCOPe 2.01
- d3ijtb_ appears in SCOPe 2.04
- d3ijtb_ is called d3ijtb1 in SCOPe 2.06
- d3ijtb_ appears in the current release, SCOPe 2.08, called d3ijtb1
View in 3D
