Lineage for d3ijta_ (3ijt A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926373Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1926664Family d.129.3.9: Smu440-like [160747] (1 protein)
    PfamB PB094079
  6. 1926665Protein Hypothetical protein SMU440 [160748] (1 species)
  7. 1926666Species Streptococcus mutans [TaxId:1309] [160749] (1 PDB entry)
    Uniprot Q8DVN6 1-137
  8. 1926667Domain d3ijta_: 3ijt A: [178350]

Details for d3ijta_

PDB Entry: 3ijt (more details), 2.38 Å

PDB Description: structural characterization of smu.440, a hypothetical protein from streptococcus mutans
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3ijta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ijta_ d.129.3.9 (A:) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]}
rgsmkfsfelavntkkedawtyysqvnqwfvwegdleqislegefttgqkgkmkmedmpe
laftlvevrenqcfsdltatpfgnvlfeheilenpdgtislrhsvsltdsdtteealafl
kqifadvpesvgklkqilet

SCOPe Domain Coordinates for d3ijta_:

Click to download the PDB-style file with coordinates for d3ijta_.
(The format of our PDB-style files is described here.)

Timeline for d3ijta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ijtb_