| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
| Family d.80.1.3: MIF-related [55339] (3 proteins) |
| Protein Microphage migration inhibition factor (MIF) [55340] (6 species) synonym: glycosylation-inhibiting factor (GIF) |
| Species Human (Homo sapiens) [TaxId:9606] [55341] (27 PDB entries) |
| Domain d3ijgc_: 3ijg C: [178343] automated match to d1ca7a_ complexed with avr, cl |
PDB Entry: 3ijg (more details), 1.7 Å
SCOPe Domain Sequences for d3ijgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ijgc_ d.80.1.3 (C:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
Timeline for d3ijgc_: