SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3iira_ (3iir A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053846Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2053956Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2053957Protein automated matches [190445] (6 species)
    not a true protein
  7. 2054004Species Murraya koenigii [TaxId:311449] [189153] (3 PDB entries)
  8. 2054007Domain d3iira_: 3iir A: [178337]
    automated match to d1r8na_

Details for d3iira_

PDB Entry: 3iir (more details), 2.9 Å

PDB Description: Crystal Structure of Miraculin like protein from seeds of Murraya koenigii
PDB Compounds: (A:) trypsin inhibitor

SCOPe Domain Sequences for d3iira_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iira_ b.42.4.0 (A:) automated matches {Murraya koenigii [TaxId: 311449]}
dplldingnvveasrdyylvsviggaggggltlyrgrnelcpldviqlspdlhkgtrlrf
aaynntsiiheavdlnvkfstetscneptvwrvdnydpsrgkwfittggvegnpgaqtlk
nwfklervgtdqgtyeivhcpsvckscvflcndvgvsydyrrrlaltagnervfgvvivp
anegsascvs

SCOPe Domain Coordinates for d3iira_:

Click to download the PDB-style file with coordinates for d3iira_.
(The format of our PDB-style files is described here.)

Timeline for d3iira_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3iirb_