SCOPe 2.08: Domain d3iima1: 3iim A:1-172

Lineage for d3iima1 (3iim A:1-172)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187523] (8 PDB entries)

8. Domain d3iima1: 3iim A:1-172 [178334]
   Other proteins in same PDB: d3iima2
   automated match to d1rkba_
   complexed with dat, dtv, epe, so4

Details for d3iima1

PDB Entry: 3iim, 2 Å

PDB Description: The structure of hCINAP-dADP complex at 2.0 angstroms resolution

PDB Compounds: (A:) Coilin-interacting nuclear ATPase protein

SCOPe Domain Sequences for d3iima1:

Sequence; same for both SEQRES and ATOM records:

>d3iima1 c.37.1.1 (A:1-172) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mllpnilltgtpgvgkttlgkelasksglkyinvgdlareeqlydgydeeydcpildedr
vvdeldnqmreggvivdyhgcdffperwfhivfvlrtdtnvlyerletrgynekkltdni
qceifqvlyeeatasykeeivhqlpsnkpeelennvdqilkwieqwikdhns

Timeline for d3iima1:

• d3iima1 first appeared in SCOPe 2.01, called d3iima_
  
• d3iima1 appears in SCOPe 2.07