Lineage for d3iika_ (3iik A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1162957Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1163373Protein automated matches [190087] (5 species)
    not a true protein
  7. 1163380Species Human (Homo sapiens) [TaxId:9606] [187523] (6 PDB entries)
  8. 1163387Domain d3iika_: 3iik A: [178332]
    automated match to d1rkba_
    complexed with so4

Details for d3iika_

PDB Entry: 3iik (more details), 1.95 Å

PDB Description: The structure of hCINAP-SO4 complex at 1.95 angstroms resolution
PDB Compounds: (A:) Coilin-interacting nuclear ATPase protein

SCOPe Domain Sequences for d3iika_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iika_ c.37.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pefmllpnilltgtpgvgkttlgkelasksglkyinvgdlareeqlydgydeeydcpild
edrvvdeldnqmreggvivdyhgcdffperwfhivfvlrtdtnvlyerletrgynekklt
dniqceifqvlyeeatasykeeivhqlpsnkpeelennvdqilkwieqwikdhns

SCOPe Domain Coordinates for d3iika_:

Click to download the PDB-style file with coordinates for d3iika_.
(The format of our PDB-style files is described here.)

Timeline for d3iika_: