| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
| Protein automated matches [190087] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187523] (6 PDB entries) |
| Domain d3iika_: 3iik A: [178332] automated match to d1rkba_ complexed with so4 |
PDB Entry: 3iik (more details), 1.95 Å
SCOPe Domain Sequences for d3iika_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iika_ c.37.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pefmllpnilltgtpgvgkttlgkelasksglkyinvgdlareeqlydgydeeydcpild
edrvvdeldnqmreggvivdyhgcdffperwfhivfvlrtdtnvlyerletrgynekklt
dniqceifqvlyeeatasykeeivhqlpsnkpeelennvdqilkwieqwikdhns
Timeline for d3iika_: