Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein automated matches [190087] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187523] (8 PDB entries) |
Domain d3iija1: 3iij A:1-172 [178331] Other proteins in same PDB: d3iija2 automated match to d1rkba_ complexed with adp, so4 |
PDB Entry: 3iij (more details), 1.76 Å
SCOPe Domain Sequences for d3iija1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iija1 c.37.1.1 (A:1-172) automated matches {Human (Homo sapiens) [TaxId: 9606]} mllpnilltgtpgvgkttlgkelasksglkyinvgdlareeqlydgydeeydcpildedr vvdeldnqmreggvivdyhgcdffperwfhivfvlrtdtnvlyerletrgynekkltdni qceifqvlyeeatasykeeivhqlpsnkpeelennvdqilkwieqwikdhns
Timeline for d3iija1: