SCOPe 2.08: Domain d3ihwa1: 3ihw A:90-253

Lineage for d3ihwa1 (3ihw A:90-253)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)

8. Domain d3ihwa1: 3ihw A:90-253 [178328]
   Other proteins in same PDB: d3ihwa2
   automated match to d2bmja1
   complexed with unx

Details for d3ihwa1

PDB Entry: 3ihw, 1.92 Å

PDB Description: crystal structure of the ras-like domain of centg3

PDB Compounds: (A:) centg3

SCOPe Domain Sequences for d3ihwa1:

Sequence; same for both SEQRES and ATOM records:

>d3ihwa1 c.37.1.0 (A:90-253) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pelkvgivgnlssgksalvhryltgtyvqeespeggrfkkeivvdgqsylllirdeggpp
elqfaawvdavvfvfsledeisfqtvynyflrlcsfrnasevpmvlvgtqdaisaanprv
iddsrarklstdlkrctyyetcatyglnvervfqdvaqkvvalr

Timeline for d3ihwa1:

• d3ihwa1 first appeared in SCOPe 2.01, called d3ihwa_
  
• d3ihwa1 appears in SCOPe 2.07