| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins) |
| Protein automated matches [191020] (3 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [188809] (2 PDB entries) |
| Domain d3ihqb_: 3ihq B: [178327] Other proteins in same PDB: d3ihqa_ automated match to d1z3eb1 protein/DNA complex; protein/RNA complex; complexed with imd |
PDB Entry: 3ihq (more details), 1.9 Å
SCOPe Domain Sequences for d3ihqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ihqb_ a.60.3.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
kekvlemtieeldlsvrsynclkragintvqelankteedmmkvrnlgrksleevkakle
elglglr
Timeline for d3ihqb_: