Lineage for d3ihqb_ (3ihq B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1493674Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 1493675Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins)
  6. 1493687Protein automated matches [191020] (2 species)
    not a true protein
  7. 1493688Species Bacillus subtilis [TaxId:1423] [188809] (2 PDB entries)
  8. 1493689Domain d3ihqb_: 3ihq B: [178327]
    Other proteins in same PDB: d3ihqa_
    automated match to d1z3eb1
    protein/DNA complex; protein/RNA complex; complexed with imd

Details for d3ihqb_

PDB Entry: 3ihq (more details), 1.9 Å

PDB Description: crystal structure of reduced c10s spx in complex with the alpha c- terminal domain of rna polymeras
PDB Compounds: (B:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d3ihqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ihqb_ a.60.3.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
kekvlemtieeldlsvrsynclkragintvqelankteedmmkvrnlgrksleevkakle
elglglr

SCOPe Domain Coordinates for d3ihqb_:

Click to download the PDB-style file with coordinates for d3ihqb_.
(The format of our PDB-style files is described here.)

Timeline for d3ihqb_: