SCOPe 2.08: Domain d3ihqb_: 3ihq B:

Lineage for d3ihqb_ (3ihq B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins)

6. Protein automated matches [191020] (3 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188809] (2 PDB entries)

8. Domain d3ihqb_: 3ihq B: [178327]
   Other proteins in same PDB: d3ihqa_
   automated match to d1z3eb1
   protein/DNA complex; protein/RNA complex; complexed with imd

Details for d3ihqb_

PDB Entry: 3ihq, 1.9 Å

PDB Description: crystal structure of reduced c10s spx in complex with the alpha c- terminal domain of rna polymeras

PDB Compounds: (B:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d3ihqb_:

Sequence; same for both SEQRES and ATOM records:

>d3ihqb_ a.60.3.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
kekvlemtieeldlsvrsynclkragintvqelankteedmmkvrnlgrksleevkakle
elglglr

Timeline for d3ihqb_:

• d3ihqb_ first appeared in SCOPe 2.01
  
• d3ihqb_ appears in SCOPe 2.07