Lineage for d3ihqa_ (3ihq A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602103Family c.47.1.12: ArsC-like [69518] (4 proteins)
    Pfam PF03960
  6. 1602116Protein automated matches [190780] (3 species)
    not a true protein
  7. 1602117Species Bacillus subtilis [TaxId:1423] [188808] (2 PDB entries)
  8. 1602118Domain d3ihqa_: 3ihq A: [178326]
    Other proteins in same PDB: d3ihqb_
    automated match to d1z3ea1
    protein/DNA complex; protein/RNA complex; complexed with imd

Details for d3ihqa_

PDB Entry: 3ihq (more details), 1.9 Å

PDB Description: crystal structure of reduced c10s spx in complex with the alpha c- terminal domain of rna polymeras
PDB Compounds: (A:) Regulatory protein spx

SCOPe Domain Sequences for d3ihqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ihqa_ c.47.1.12 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mvtlytspsstscrkarawleeheipfvernifseplsideikqilrmtedgtdeiistr
skvfqklnvnvesmplqdlyrlinehpgllrrpiiidekrlqvgynedeirrflp

SCOPe Domain Coordinates for d3ihqa_:

Click to download the PDB-style file with coordinates for d3ihqa_.
(The format of our PDB-style files is described here.)

Timeline for d3ihqa_: