Lineage for d3ihoa_ (3iho A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720979Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2720980Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2720988Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins)
  6. 2721016Protein automated matches [191081] (1 species)
    not a true protein
  7. 2721017Species Human (Homo sapiens) [TaxId:9606] [189020] (3 PDB entries)
  8. 2721020Domain d3ihoa_: 3iho A: [178323]
    automated match to d1ngna_

Details for d3ihoa_

PDB Entry: 3iho (more details), 2.7 Å

PDB Description: the c-terminal glycosylase domain of human mbd4
PDB Compounds: (A:) Methyl-CpG-binding domain protein 4

SCOPe Domain Sequences for d3ihoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ihoa_ a.96.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kwtpprspfnlvqetlfhdpwklliatiflnrtsgkmaipvlwkflekypsaevartadw
rdvsellkplglydlraktivkfsdeyltkqwkypielhgigkygndsyrifcvnewkqv
hpedhklnkyhdwlwenh

SCOPe Domain Coordinates for d3ihoa_:

Click to download the PDB-style file with coordinates for d3ihoa_.
(The format of our PDB-style files is described here.)

Timeline for d3ihoa_: