Class a: All alpha proteins [46456] (290 folds) |
Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.96.1: DNA-glycosylase [48150] (7 families) |
Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins) |
Protein automated matches [191081] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189020] (3 PDB entries) |
Domain d3ihoa_: 3iho A: [178323] automated match to d1ngna_ |
PDB Entry: 3iho (more details), 2.7 Å
SCOPe Domain Sequences for d3ihoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ihoa_ a.96.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kwtpprspfnlvqetlfhdpwklliatiflnrtsgkmaipvlwkflekypsaevartadw rdvsellkplglydlraktivkfsdeyltkqwkypielhgigkygndsyrifcvnewkqv hpedhklnkyhdwlwenh
Timeline for d3ihoa_: