Lineage for d3ihlb_ (3ihl B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111791Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2112083Protein automated matches [190304] (11 species)
    not a true protein
  7. 2112095Species Human (Homo sapiens) [TaxId:9606] [189076] (3 PDB entries)
  8. 2112098Domain d3ihlb_: 3ihl B: [178322]
    automated match to d2vo1a1
    complexed with adp, po4

Details for d3ihlb_

PDB Entry: 3ihl (more details), 2.8 Å

PDB Description: Human CTPS2 crystal structure
PDB Compounds: (B:) CTP synthase 2

SCOPe Domain Sequences for d3ihlb_:

Sequence, based on SEQRES records: (download)

>d3ihlb_ c.37.1.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkyilvtggvisgigkgiiassigtilkscglrvtaikidpyinidagtfspyehgevfv
lndggevdldlgnyerfldinlykdnnittgkiyqhvinkerrgdylgktvqvvphitda
vqewvmnqakvpvdgnkeepqicvielggtigdiegmpfveafrqfqfkakrenfcnihv
slvpqlsatgeqktkptqnsvralrglglspdlivcrsstpiemavkekismfchvnpeq
vicihdvsstyrvpvlleeqsivkyfkerlhlp

Sequence, based on observed residues (ATOM records): (download)

>d3ihlb_ c.37.1.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkyilvtggvisgigkgiiassigtilkscglrvtaikidpyinidagtfspyehgevfv
lndggevqvvphitdavqewvmnqakvpvdgnkeepqicvielggtigdiegmpfveafr
qfqfkakrenfcnihvslvpqlsatgeqktkptqnsvralrglglspdlivcrsstpiem
avkekismfchvnpeqvicihdvsstyrvpvlleeqsivkyfkerlhlp

SCOPe Domain Coordinates for d3ihlb_:

Click to download the PDB-style file with coordinates for d3ihlb_.
(The format of our PDB-style files is described here.)

Timeline for d3ihlb_: