Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (51 species) not a true protein |
Species Francisella tularensis [TaxId:177416] [189018] (3 PDB entries) |
Domain d3igxb_: 3igx B: [178320] automated match to d1onra_ complexed with po4 |
PDB Entry: 3igx (more details), 1.85 Å
SCOPe Domain Sequences for d3igxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3igxb_ c.1.10.0 (B:) automated matches {Francisella tularensis [TaxId: 177416]} qksvleqlkqvtmvvadtgdfelikkykpvdattnpslilkavkeqkysnlvaetiskvk annpdlnsddlvkeiaieilvsfgikildviegkvssevdarvsfnsattidyakriiar yesngipkdrvlikiaatwegikaakllqkegincnltlifdkaqakacaeagvylvspf vgritdwqmqqnnlktfpaiadddgvnsvkaiyklykshgfktivmgasfrnveqviala gcdaltispvlleelknrdehlevkltknddvvtqspqiseadfrwlmnenamathklae girlftkdtieleniikqnl
Timeline for d3igxb_: