SCOPe 2.08: Domain d3igrb_: 3igr B:

Lineage for d3igrb_ (3igr B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Vibrio fischeri [TaxId:312309] [189017] (1 PDB entry)

8. Domain d3igrb_: 3igr B: [178314]
   automated match to d1nsla_
   complexed with gol, na

Details for d3igrb_

PDB Entry: 3igr, 2 Å

PDB Description: the crystal structure of ribosomal-protein-s5-alanine acetyltransferase from vibrio fischeri to 2.0a

PDB Compounds: (B:) Ribosomal-protein-S5-alanine N-acetyltransferase

SCOPe Domain Sequences for d3igrb_:

Sequence; same for both SEQRES and ATOM records:

>d3igrb_ d.108.1.0 (B:) automated matches {Vibrio fischeri [TaxId: 312309]}
dvsfefehyqvrlikssdavtianyfmrnrhhlapwepkrshafftpegwkqrllqlvel
hkhnlafyfvvvdknehkiigtvsysnitrfpfhaghvgysldseyqgkgimrravnvti
dwmfkaqnlhrimaayiprneksakvlaalgfvkegeakkylyingawedhiltskindd
wkp

Timeline for d3igrb_:

• d3igrb_ first appeared in SCOPe 2.01
  
• d3igrb_ appears in SCOPe 2.07