Lineage for d3igrb_ (3igr B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969645Species Vibrio fischeri [TaxId:312309] [189017] (1 PDB entry)
  8. 2969647Domain d3igrb_: 3igr B: [178314]
    automated match to d1nsla_
    complexed with gol, na

Details for d3igrb_

PDB Entry: 3igr (more details), 2 Å

PDB Description: the crystal structure of ribosomal-protein-s5-alanine acetyltransferase from vibrio fischeri to 2.0a
PDB Compounds: (B:) Ribosomal-protein-S5-alanine N-acetyltransferase

SCOPe Domain Sequences for d3igrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3igrb_ d.108.1.0 (B:) automated matches {Vibrio fischeri [TaxId: 312309]}
dvsfefehyqvrlikssdavtianyfmrnrhhlapwepkrshafftpegwkqrllqlvel
hkhnlafyfvvvdknehkiigtvsysnitrfpfhaghvgysldseyqgkgimrravnvti
dwmfkaqnlhrimaayiprneksakvlaalgfvkegeakkylyingawedhiltskindd
wkp

SCOPe Domain Coordinates for d3igrb_:

Click to download the PDB-style file with coordinates for d3igrb_.
(The format of our PDB-style files is described here.)

Timeline for d3igrb_: