SCOPe 2.01: Domain d3igra_: 3igr A:

Lineage for d3igra_ (3igr A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (8 species)
   not a true protein

7. Species Vibrio fischeri [TaxId:312309] [189017] (1 PDB entry)

8. Domain d3igra_: 3igr A: [178313]
   automated match to d1nsla_
   complexed with gol, na

Details for d3igra_

PDB Entry: 3igr, 2 Å

PDB Description: the crystal structure of ribosomal-protein-s5-alanine acetyltransferase from vibrio fischeri to 2.0a

PDB Compounds: (A:) Ribosomal-protein-S5-alanine N-acetyltransferase

SCOPe Domain Sequences for d3igra_:

Sequence; same for both SEQRES and ATOM records:

>d3igra_ d.108.1.0 (A:) automated matches {Vibrio fischeri [TaxId: 312309]}
dvsfefehyqvrlikssdavtianyfmrnrhhlapwepkrshafftpegwkqrllqlvel
hkhnlafyfvvvdknehkiigtvsysnitrfpfhaghvgysldseyqgkgimrravnvti
dwmfkaqnlhrimaayiprneksakvlaalgfvkegeakkylyingawedhiltskindd
wkp

Timeline for d3igra_:

• d3igra_ is new in SCOPe 2.01-stable
  
• d3igra_ appears in SCOPe 2.02
  
• d3igra_ appears in the current release, SCOPe 2.08