Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (8 species) not a true protein |
Species Vibrio fischeri [TaxId:312309] [189017] (1 PDB entry) |
Domain d3igra_: 3igr A: [178313] automated match to d1nsla_ complexed with gol, na |
PDB Entry: 3igr (more details), 2 Å
SCOPe Domain Sequences for d3igra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3igra_ d.108.1.0 (A:) automated matches {Vibrio fischeri [TaxId: 312309]} dvsfefehyqvrlikssdavtianyfmrnrhhlapwepkrshafftpegwkqrllqlvel hkhnlafyfvvvdknehkiigtvsysnitrfpfhaghvgysldseyqgkgimrravnvti dwmfkaqnlhrimaayiprneksakvlaalgfvkegeakkylyingawedhiltskindd wkp
Timeline for d3igra_: