Lineage for d3igka_ (3igk A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2034243Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2034244Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 protein domains)
  6. 2034245Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 2034246Species Human (Homo sapiens) [TaxId:9606] [49420] (40 PDB entries)
  8. 2034253Domain d3igka_: 3igk A: [178310]
    automated match to d1gzha_
    protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3igka_

PDB Entry: 3igk (more details), 1.7 Å

PDB Description: Diversity in DNA recognition by p53 revealed by crystal structures with Hoogsteen base pairs (p53-DNA complex 2)
PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d3igka_:

Sequence, based on SEQRES records: (download)

>d3igka_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
gtrvramaiykqsqrmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
hsvvvpyeppevgsdcttihynymcnsscmggmnrspiltiitledssgnllgrnsfevr
vcacpgrdrrteeenlrkkg

Sequence, based on observed residues (ATOM records): (download)

>d3igka_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
gtrvramaiykqsqrmtevvrrcphhercsglappqhlirvegnlrveylddrntfrhsv
vvpyeppevgsdcttihynymcnsscmggmnrspiltiitledssgnllgrnsfevrvca
cpgrdrrteeenlrkkg

SCOPe Domain Coordinates for d3igka_:

Click to download the PDB-style file with coordinates for d3igka_.
(The format of our PDB-style files is described here.)

Timeline for d3igka_: