SCOPe 2.04: Domain d3igjc_: 3igj C:

Lineage for d3igjc_ (3igj C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (25 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188916] (2 PDB entries)

8. Domain d3igjc_: 3igj C: [178309]
   automated match to d1ocxa_
   complexed with aco, fmt, gol, so4

Details for d3igjc_

PDB Entry: 3igj, 2.6 Å

PDB Description: crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis

PDB Compounds: (C:) maltose o-acetyltransferase

SCOPe Domain Sequences for d3igjc_:

Sequence; same for both SEQRES and ATOM records:

>d3igjc_ b.81.1.0 (C:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
amktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgssad
gkaqinpdfrcdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathplhp
vernsgkeygkpvkignnvwvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggnpa
kviktiee

Timeline for d3igjc_:

• d3igjc_ first appeared in SCOPe 2.01
  
• d3igjc_ appears in SCOPe 2.03
  
• d3igjc_ appears in SCOPe 2.05
  
• d3igjc_ appears in the current release, SCOPe 2.08, called d3igjc1