Lineage for d3igjb_ (3igj B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962569Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 962570Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 962820Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 962821Protein automated matches [190967] (6 species)
    not a true protein
  7. 962822Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188916] (2 PDB entries)
  8. 962827Domain d3igjb_: 3igj B: [178308]
    automated match to d1ocxa_
    complexed with aco, fmt, gol, so4

Details for d3igjb_

PDB Entry: 3igj (more details), 2.6 Å

PDB Description: crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
PDB Compounds: (B:) maltose o-acetyltransferase

SCOPe Domain Sequences for d3igjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3igjb_ b.81.1.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgssadg
kaqinpdfrcdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathplhpv
ernsgkeygkpvkignnvwvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggnpak
viktiee

SCOPe Domain Coordinates for d3igjb_:

Click to download the PDB-style file with coordinates for d3igjb_.
(The format of our PDB-style files is described here.)

Timeline for d3igjb_: