| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.53: p53 tetramerization domain [47718] (1 superfamily) core: 4 helices; bundle |
Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) ![]() homotetramer |
| Family a.53.1.1: p53 tetramerization domain [47720] (1 protein) |
| Protein p53 tetramerization domain [47721] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47722] (18 PDB entries) |
| Domain d1aiea_: 1aie A: [17829] true tetrameric structure can be generated from crystallographic symmetry independent NMR structures in other entries are somewhat different |
PDB Entry: 1aie (more details), 1.5 Å
SCOPe Domain Sequences for d1aiea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aiea_ a.53.1.1 (A:) p53 tetramerization domain {Human (Homo sapiens) [TaxId: 9606]}
eyftlqirgrerfemfrelnealelkdaqag
Timeline for d1aiea_: