SCOPe 2.01: Domain d3iejb_: 3iej B:

Lineage for d3iejb_ (3iej B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (23 PDB entries)

8. Domain d3iejb_: 3iej B: [178272]
   automated match to d1gloa_
   complexed with 599

Details for d3iejb_

PDB Entry: 3iej, 2.18 Å

PDB Description: pyrazole-based cathepsin s inhibitors with arylalkynes as p1 binding elements

PDB Compounds: (B:) cathepsin S

SCOPe Domain Sequences for d3iejb_:

Sequence; same for both SEQRES and ATOM records:

>d3iejb_ d.3.1.1 (B:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
alpdsvdwrekgcvtevkyqgscgaswafsavgaleaqlklktgklvslsaqnlvdcste
kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
wlvknswghnfgeegyirmarnkgnhcgiasfpsypeilqg

Timeline for d3iejb_:

• d3iejb_ is new in SCOPe 2.01-stable
  
• d3iejb_ appears in SCOPe 2.02
  
• d3iejb_ appears in the current release, SCOPe 2.08, called d3iejb1