Lineage for d3iejb1 (3iej B:1-217)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926699Protein (Pro)cathepsin S [82566] (1 species)
  7. 2926700Species Human (Homo sapiens) [TaxId:9606] [82567] (28 PDB entries)
  8. 2926723Domain d3iejb1: 3iej B:1-217 [178272]
    Other proteins in same PDB: d3ieja2, d3ieja3, d3iejb2, d3iejb3
    automated match to d1gloa_
    complexed with 599

Details for d3iejb1

PDB Entry: 3iej (more details), 2.18 Å

PDB Description: pyrazole-based cathepsin s inhibitors with arylalkynes as p1 binding elements
PDB Compounds: (B:) cathepsin S

SCOPe Domain Sequences for d3iejb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iejb1 d.3.1.1 (B:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgaswafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

SCOPe Domain Coordinates for d3iejb1:

Click to download the PDB-style file with coordinates for d3iejb1.
(The format of our PDB-style files is described here.)

Timeline for d3iejb1: