Lineage for d3ieaa_ (3iea A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 940170Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 940171Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 940172Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 940173Protein Amicyanin [49505] (2 species)
  7. 940174Species Paracoccus denitrificans [TaxId:266] [49506] (33 PDB entries)
    Uniprot P22364
  8. 940215Domain d3ieaa_: 3iea A: [178265]
    automated match to d1aaca_
    complexed with act, cl, cu, po4, zn; mutant

Details for d3ieaa_

PDB Entry: 3iea (more details), 2.2 Å

PDB Description: structure of reduced m98l mutant of amicyanin
PDB Compounds: (A:) amicyanin

SCOPe Domain Sequences for d3ieaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ieaa_ b.6.1.1 (A:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpflrgkvvve

SCOPe Domain Coordinates for d3ieaa_:

Click to download the PDB-style file with coordinates for d3ieaa_.
(The format of our PDB-style files is described here.)

Timeline for d3ieaa_: