Lineage for d3ie5b_ (3ie5 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040331Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1040549Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1040785Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 1040786Protein automated matches [190218] (4 species)
    not a true protein
  7. 1040789Species Hypericum perforatum [TaxId:65561] [189103] (1 PDB entry)
  8. 1040791Domain d3ie5b_: 3ie5 B: [178263]
    automated match to d1e09a_
    complexed with 1pe, cl, pe8, peg, pg4, pge

Details for d3ie5b_

PDB Entry: 3ie5 (more details), 1.69 Å

PDB Description: crystal structure of hyp-1 protein from hypericum perforatum (st john's wort) involved in hypericin biosynthesis
PDB Compounds: (B:) Phenolic oxidative coupling protein Hyp-1

SCOPe Domain Sequences for d3ie5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ie5b_ d.129.3.0 (B:) automated matches {Hypericum perforatum [TaxId: 65561]}
idpftmaaytivkeeespiaphrlfkalvlerhqvlvkaqphvfksgeiiegdggvgtvt
kitfvdghpltymlhkfdeidaanfyckytlfegdvlrdniekvvyevkleavgggskgk
itvtyhpkpgctvneeevkigekkayefykqveeylaanpevfa

SCOPe Domain Coordinates for d3ie5b_:

Click to download the PDB-style file with coordinates for d3ie5b_.
(The format of our PDB-style files is described here.)

Timeline for d3ie5b_: