SCOPe 2.01: Domain d3ie5a_: 3ie5 A:

Lineage for d3ie5a_ (3ie5 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (4 species)
   not a true protein

7. Species Hypericum perforatum [TaxId:65561] [189103] (1 PDB entry)

8. Domain d3ie5a_: 3ie5 A: [178262]
   automated match to d1e09a_
   complexed with 1pe, cl, pe8, peg, pg4, pge

Details for d3ie5a_

PDB Entry: 3ie5, 1.69 Å

PDB Description: crystal structure of hyp-1 protein from hypericum perforatum (st john's wort) involved in hypericin biosynthesis

PDB Compounds: (A:) Phenolic oxidative coupling protein Hyp-1

SCOPe Domain Sequences for d3ie5a_:

Sequence; same for both SEQRES and ATOM records:

>d3ie5a_ d.129.3.0 (A:) automated matches {Hypericum perforatum [TaxId: 65561]}
tmaaytivkeeespiaphrlfkalvlerhqvlvkaqphvfksgeiiegdggvgtvtkitf
vdghpltymlhkfdeidaanfyckytlfegdvlrdniekvvyevkleavgggskgkitvt
yhpkpgctvneeevkigekkayefykqveeylaanpevfa

Timeline for d3ie5a_:

• d3ie5a_ is new in SCOPe 2.01-stable
  
• d3ie5a_ appears in SCOPe 2.02
  
• d3ie5a_ appears in the current release, SCOPe 2.08, called d3ie5a1