Lineage for d1bipa_ (1bip A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323688Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2323689Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2323746Family a.52.1.2: Proteinase/alpha-amylase inhibitors [47708] (3 proteins)
  6. 2323757Protein Trypsin/alpha-amylase inhibitor RBI [47711] (1 species)
  7. 2323758Species Eleusine coracana, seeds [TaxId:4511] [47712] (3 PDB entries)
  8. 2323761Domain d1bipa_: 1bip A: [17825]

Details for d1bipa_

PDB Entry: 1bip (more details)

PDB Description: bifunctional proteinase inhibitor trypsin/a-amylase from seeds of ragi (eleusine coracana gaertneri)
PDB Compounds: (A:) alpha-amylase/trypsin inhibitor

SCOPe Domain Sequences for d1bipa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bipa_ a.52.1.2 (A:) Trypsin/alpha-amylase inhibitor RBI {Eleusine coracana, seeds [TaxId: 4511]}
svgtscipgmaiphnpldscrwyvstrtcgvgprlatqemkarccrqleaipaycrceav
rilmdgvvtssgqhegrllqdlpgcprqvqrafapklvtevecnlatihggpfclsllga
ge

SCOPe Domain Coordinates for d1bipa_:

Click to download the PDB-style file with coordinates for d1bipa_.
(The format of our PDB-style files is described here.)

Timeline for d1bipa_: