![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
![]() | Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) ![]() can be classified as disulfide-rich |
![]() | Family a.52.1.2: Proteinase/alpha-amylase inhibitors [47708] (3 proteins) |
![]() | Protein Trypsin/alpha-amylase inhibitor RBI [47711] (1 species) |
![]() | Species Eleusine coracana, seeds [TaxId:4511] [47712] (3 PDB entries) |
![]() | Domain d1bipa_: 1bip A: [17825] |
PDB Entry: 1bip (more details)
SCOPe Domain Sequences for d1bipa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bipa_ a.52.1.2 (A:) Trypsin/alpha-amylase inhibitor RBI {Eleusine coracana, seeds [TaxId: 4511]} svgtscipgmaiphnpldscrwyvstrtcgvgprlatqemkarccrqleaipaycrceav rilmdgvvtssgqhegrllqdlpgcprqvqrafapklvtevecnlatihggpfclsllga ge
Timeline for d1bipa_: