Lineage for d3idxg_ (3idx G:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1683292Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 1683293Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 1683294Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 1683295Protein gp120 core [56504] (2 species)
  7. 1683296Species Human immunodeficiency virus type 1 [TaxId:11676] [56505] (18 PDB entries)
  8. 1683304Domain d3idxg_: 3idx G: [178245]
    Other proteins in same PDB: d3idxl1, d3idxl2
    automated match to d1g9mg_
    complexed with epe, gol, nag, so4

Details for d3idxg_

PDB Entry: 3idx (more details), 2.5 Å

PDB Description: Crystal structure of HIV-gp120 core in complex with CD4-binding site antibody b13, space group C222
PDB Compounds: (G:) HIV-1 HxBc2 gp120 core

SCOPe Domain Sequences for d3idxg_:

Sequence, based on SEQRES records: (download)

>d3idxg_ d.172.1.1 (G:) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
evvlvnvtenfnwckndmveqmhedicslwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvssqlllngsla
eeevvirscnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
nktiifkqssggdpeivthwfncggeffycnstqlfnstwfnstwstegsnntegsdtit
lpcrikqiinmwckvgkmmyappisgqircssnitgllltrdggnsnneseifrpgggdm
rdnwrselykykvvkie

Sequence, based on observed residues (ATOM records): (download)

>d3idxg_ d.172.1.1 (G:) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
evvlvnvtenfnwckndmveqmhedicslwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvssqlllngsla
eeevvirscnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
nktiifkqssggdpeivthwfncggeffycnstqlfnstwfnsgsdtitlpcrikqiinm
wckvgkmmyappisgqircssnitgllltrdggnsnneseifrpgggdmrdnwrselyky
kvvkie

SCOPe Domain Coordinates for d3idxg_:

Click to download the PDB-style file with coordinates for d3idxg_.
(The format of our PDB-style files is described here.)

Timeline for d3idxg_: