Lineage for d3icib1 (3ici B:2-184)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064271Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2064272Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2064273Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 protein domains)
    automatically mapped to Pfam PF00160
  6. 2064542Protein automated matches [190077] (18 species)
    not a true protein
  7. 2064564Species Human (Homo sapiens) [TaxId:9606] [186915] (20 PDB entries)
  8. 2064579Domain d3icib1: 3ici B:2-184 [178240]
    Other proteins in same PDB: d3icia2, d3icib2
    automated match to d1cyna_
    complexed with mes, zn

Details for d3icib1

PDB Entry: 3ici (more details), 1.7 Å

PDB Description: Crystal structure of cyclophilin B in complex with calmegin fragment
PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase B

SCOPe Domain Sequences for d3icib1:

Sequence, based on SEQRES records: (download)

>d3icib1 b.62.1.1 (B:2-184) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dekkkgpkvtvkvyfdlrigdedvgrvifglfgktvpktvdnfvalatgekgfgyknskf
hrvikdfmiqggdftrgdgtggksiygerfpdenfklkhygpgwvsmanagkdtngsqff
ittvktawldgkhvvfgkvlegmevvrkvestktdsrdkplkdviiadcgkievekpfai
ake

Sequence, based on observed residues (ATOM records): (download)

>d3icib1 b.62.1.1 (B:2-184) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dekgpkvtvkvyfdlrigdedvgrvifglfgktvpktvdnfvalatgekgfgyknskfhr
vikdfmiqggdftrgdgtggksiygerfpdenfklkhygpgwvsmanagkdtngsqffit
tvktawldgkhvvfgkvlegmevvrkvestktdsrdkplkdviiadcgkievekpfaiak
e

SCOPe Domain Coordinates for d3icib1:

Click to download the PDB-style file with coordinates for d3icib1.
(The format of our PDB-style files is described here.)

Timeline for d3icib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3icib2