Lineage for d1tmqb_ (1tmq B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4068Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
  4. 4069Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (3 families) (S)
  5. 4091Family a.52.1.2: Proteinase/alpha-amylase inhibitors [47708] (3 proteins)
  6. 4102Protein Trypsin/alpha-amylase inhibitor RBI [47711] (1 species)
  7. 4103Species Ragi (Elucine coracana gaertneri), seeds [47712] (3 PDB entries)
  8. 4104Domain d1tmqb_: 1tmq B: [17824]
    Other proteins in same PDB: d1tmqa1, d1tmqa2

Details for d1tmqb_

PDB Entry: 1tmq (more details), 2.5 Å

PDB Description: structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor

SCOP Domain Sequences for d1tmqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tmqb_ a.52.1.2 (B:) Trypsin/alpha-amylase inhibitor RBI {Ragi (Elucine coracana gaertneri), seeds}
svgtscipgmaiphnpldscrwyvstrtcgvgprlatqemkarccrqleaipaycrceav
rilmdgvvtssgqhegrllqdlpgcprqvqrafapklvtevecnlatihggpfclsl

SCOP Domain Coordinates for d1tmqb_:

Click to download the PDB-style file with coordinates for d1tmqb_.
(The format of our PDB-style files is described here.)

Timeline for d1tmqb_: