| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) ![]() can be classified as disulfide-rich |
| Family a.52.1.2: Proteinase/alpha-amylase inhibitors [47708] (3 proteins) |
| Protein Trypsin/alpha-amylase inhibitor RBI [47711] (1 species) |
| Species Eleusine coracana, seeds [TaxId:4511] [47712] (3 PDB entries) |
| Domain d1tmqb_: 1tmq B: [17824] Other proteins in same PDB: d1tmqa1, d1tmqa2 complexed with ca, cl |
PDB Entry: 1tmq (more details), 2.5 Å
SCOPe Domain Sequences for d1tmqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tmqb_ a.52.1.2 (B:) Trypsin/alpha-amylase inhibitor RBI {Eleusine coracana, seeds [TaxId: 4511]}
svgtscipgmaiphnpldscrwyvstrtcgvgprlatqemkarccrqleaipaycrceav
rilmdgvvtssgqhegrllqdlpgcprqvqrafapklvtevecnlatihggpfclsl
Timeline for d1tmqb_: