SCOPe 2.05: Domain d3icia_: 3ici A:

Lineage for d3icia_ (3ici A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186915] (15 PDB entries)

8. Domain d3icia_: 3ici A: [178239]
   automated match to d1cyna_
   complexed with mes, zn

Details for d3icia_

PDB Entry: 3ici, 1.7 Å

PDB Description: Crystal structure of cyclophilin B in complex with calmegin fragment

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase B

SCOPe Domain Sequences for d3icia_:

Sequence, based on SEQRES records:

>d3icia_ b.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gplgsdekkkgpkvtvkvyfdlrigdedvgrvifglfgktvpktvdnfvalatgekgfgy
knskfhrvikdfmiqggdftrgdgtggksiygerfpdenfklkhygpgwvsmanagkdtn
gsqffittvktawldgkhvvfgkvlegmevvrkvestktdsrdkplkdviiadcgkieve
kpfaiake

Sequence, based on observed residues (ATOM records):

>d3icia_ b.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gplgsdekkgpkvtvkvyfdlrigdedvgrvifglfgktvpktvdnfvalatgekgfgyk
nskfhrvikdfmiqggdftrgdgtggksiygerfpdenfklkhygpgwvsmanagkdtng
sqffittvktawldgkhvvfgkvlegmevvrkvestktdsrdkplkdviiadcgkievek
pfaiake

Timeline for d3icia_:

• d3icia_ first appeared in SCOPe 2.01
  
• d3icia_ appears in SCOPe 2.04
  
• d3icia_ is called d3icia1 in SCOPe 2.06
  
• d3icia_ appears in the current release, SCOPe 2.08, called d3icia1