Lineage for d3iara1 (3iar A:5-363)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442005Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins)
  6. 2442006Protein Adenosine deaminase (ADA) [51558] (4 species)
    Common fold covers the whole protein structure
  7. 2442027Species Human (Homo sapiens) [TaxId:9606] [224876] (1 PDB entry)
  8. 2442028Domain d3iara1: 3iar A:5-363 [178216]
    Other proteins in same PDB: d3iara2
    automated match to d1w1ie_
    complexed with 3d1, gol, ni, no3

Details for d3iara1

PDB Entry: 3iar (more details), 1.52 Å

PDB Description: The crystal structure of human adenosine deaminase
PDB Compounds: (A:) adenosine deaminase

SCOPe Domain Sequences for d3iara1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iara1 c.1.9.1 (A:5-363) Adenosine deaminase (ADA) {Human (Homo sapiens) [TaxId: 9606]}
pafdkpkvelhvhldgsikpetilyygrrrgialpantaegllnvigmdkpltlpdflak
fdyympaiagcreaikriayefvemkakegvvyvevrysphllanskvepipwnqaegdl
tpdevvalvgqglqegerdfgvkarsilccmrhqpnwspkvvelckkyqqqtvvaidlag
detipgssllpghvqayqeavksgihrtvhagevgsaevvkeavdilkterlghgyhtle
dqalynrlrqenmhfeicpwssyltgawkpdtehavirlkndqanyslntddplifkstl
dtdyqmtkrdmgfteeefkrlninaakssflpedekrelldllykaygmppsasagqnl

SCOPe Domain Coordinates for d3iara1:

Click to download the PDB-style file with coordinates for d3iara1.
(The format of our PDB-style files is described here.)

Timeline for d3iara1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3iara2