Lineage for d3iaha_ (3iah A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848392Species Salmonella enterica [TaxId:99287] [189011] (1 PDB entry)
  8. 2848393Domain d3iaha_: 3iah A: [178209]
    automated match to d2c07a1
    complexed with act, cl, eoh, nap

Details for d3iaha_

PDB Entry: 3iah (more details), 1.83 Å

PDB Description: crystal structure of short chain dehydrogenase (ycik) from salmonella enterica subsp. enterica serovar typhimurium str. lt2 in complex with nadp and acetate.
PDB Compounds: (A:) Short Chain Dehydrogenase yciK

SCOPe Domain Sequences for d3iaha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iaha_ c.2.1.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
mhyqpkqdllqnriilvtgasdgigreaaltyarygatvillgrneeklrrvaqhiadeq
hvqpqwftldlltctaeecrqvadriaahyprldgvlhnagllgeigpmseqdpqiwqdv
mqvnvnatfmltqallplllksdagslvftsssvgrqgranwgayatskfategmmqvla
deyqnrslrvncinpggtrtsmrasafptedpqklktpadimplylwlmgddsrrktgmt
fdaqpgrkpgiaq

SCOPe Domain Coordinates for d3iaha_:

Click to download the PDB-style file with coordinates for d3iaha_.
(The format of our PDB-style files is described here.)

Timeline for d3iaha_: