Lineage for d3ia8b_ (3ia8 B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957981Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 957982Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 958632Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 958633Protein automated matches [190698] (4 species)
    not a true protein
  7. 958634Species Human (Homo sapiens) [TaxId:9606] [187833] (4 PDB entries)
  8. 958637Domain d3ia8b_: 3ia8 B: [178205]
    automated match to d2a13a1
    complexed with hem

Details for d3ia8b_

PDB Entry: 3ia8 (more details), 1.79 Å

PDB Description: the structure of the c-terminal heme nitrobindin domain of thap domain-containing protein 4 from homo sapiens
PDB Compounds: (B:) THAP domain-containing protein 4

SCOPe Domain Sequences for d3ia8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ia8b_ b.60.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppkmnpvveplswmlgtwlsdppgagtyptlqpfqyleevhishvgqpmlnfsfnsfhpd
trkpmhrecgfirlkpdtnkvafvsaqntgvveveegevngqelciashsiarisfakep
hveqitrkfrlnsegkleqtvsmatttqpmtqhlhvtykkvt

SCOPe Domain Coordinates for d3ia8b_:

Click to download the PDB-style file with coordinates for d3ia8b_.
(The format of our PDB-style files is described here.)

Timeline for d3ia8b_: