SCOPe 2.01: Domain d3ia8a_: 3ia8 A:

Lineage for d3ia8a_ (3ia8 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187833] (4 PDB entries)

8. Domain d3ia8a_: 3ia8 A: [178204]
   automated match to d2a13a1
   complexed with hem

Details for d3ia8a_

PDB Entry: 3ia8, 1.79 Å

PDB Description: the structure of the c-terminal heme nitrobindin domain of thap domain-containing protein 4 from homo sapiens

PDB Compounds: (A:) THAP domain-containing protein 4

SCOPe Domain Sequences for d3ia8a_:

Sequence; same for both SEQRES and ATOM records:

>d3ia8a_ b.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppkmnpvveplswmlgtwlsdppgagtyptlqpfqyleevhishvgqpmlnfsfnsfhpd
trkpmhrecgfirlkpdtnkvafvsaqntgvveveegevngqelciashsiarisfakep
hveqitrkfrlnsegkleqtvsmatttqpmtqhlhvtykkvt

Timeline for d3ia8a_:

• d3ia8a_ is new in SCOPe 2.01-stable
  
• d3ia8a_ appears in SCOPe 2.02
  
• d3ia8a_ appears in the current release, SCOPe 2.08