Lineage for d3ia5a_ (3ia5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904242Species Moritella profunda [TaxId:111291] [189013] (3 PDB entries)
  8. 2904249Domain d3ia5a_: 3ia5 A: [178200]
    automated match to d1dhja_
    complexed with po4

Details for d3ia5a_

PDB Entry: 3ia5 (more details), 2.1 Å

PDB Description: Moritella profunda dihydrofolate reductase (DHFR)
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3ia5a_:

Sequence, based on SEQRES records: (download)

>d3ia5a_ c.71.1.0 (A:) automated matches {Moritella profunda [TaxId: 111291]}
mivsmiaalannrvigldnkmpwhlpaelqlfkratlgkpivmgrntfesigrplpgrln
ivlsrqtdyqpegvtvvatledavvaagdveelmiiggatiynqclaaadrlylthielt
tegdtwfpdyeqynwqeiehesyaaddknphnyrfsllerv

Sequence, based on observed residues (ATOM records): (download)

>d3ia5a_ c.71.1.0 (A:) automated matches {Moritella profunda [TaxId: 111291]}
mivsmiaalannrvigldnkmpwhlpaelqlfkratlgkpivmgrntfesigrplpgrln
ivlstdyqpegvtvvatledavvaagdveelmiiggatiynqclaaadrlylthieltte
gdtwfpdyeqynwqeiehesyaaddknphnyrfsllerv

SCOPe Domain Coordinates for d3ia5a_:

Click to download the PDB-style file with coordinates for d3ia5a_.
(The format of our PDB-style files is described here.)

Timeline for d3ia5a_: