Lineage for d3ia4a_ (3ia4 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1004246Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1004247Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1004553Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1004554Protein automated matches [190777] (8 species)
    not a true protein
  7. 1004613Species Moritella profunda [TaxId:111291] [189013] (3 PDB entries)
  8. 1004614Domain d3ia4a_: 3ia4 A: [178196]
    automated match to d1dhja_
    complexed with mtx, ndp

Details for d3ia4a_

PDB Entry: 3ia4 (more details), 1.7 Å

PDB Description: Moritella profunda dihydrofolate reductase (DHFR) in complex with NADPH and methotrexate (MTX)
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3ia4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ia4a_ c.71.1.0 (A:) automated matches {Moritella profunda [TaxId: 111291]}
mivsmiaalannrvigldnkmpwhlpaelqlfkratlgkpivmgrntfesigrplpgrln
ivlsrqtdyqpegvtvvatledavvaagdveelmiiggatiynqclaaadrlylthielt
tegdtwfpdyeqynwqeiehesyaaddknphnyrfsllerv

SCOPe Domain Coordinates for d3ia4a_:

Click to download the PDB-style file with coordinates for d3ia4a_.
(The format of our PDB-style files is described here.)

Timeline for d3ia4a_: