![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.12: Haloperoxidase [53531] (8 proteins) automatically mapped to Pfam PF12697 automatically mapped to Pfam PF00561 |
![]() | Protein automated matches [190860] (3 species) not a true protein |
![]() | Species Pseudomonas fluorescens [TaxId:294] [189239] (5 PDB entries) |
![]() | Domain d3ia2f_: 3ia2 F: [178195] automated match to d1va4a_ complexed with gol, j6z, so4 |
PDB Entry: 3ia2 (more details), 1.65 Å
SCOPe Domain Sequences for d3ia2f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ia2f_ c.69.1.12 (F:) automated matches {Pseudomonas fluorescens [TaxId: 294]} stfvakdgtqiyfkdwgsgkpvlfshgwlldadmweyqmeylssrgyrtiafdrrgfgrs dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg aelkvykdaphgfavthaqqlnedllaflkr
Timeline for d3ia2f_: