Lineage for d3i9qa_ (3i9q A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2053739Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 2053740Species Chicken (Gallus gallus) [TaxId:9031] [50059] (38 PDB entries)
  8. 2053743Domain d3i9qa_: 3i9q A: [178188]
    automated match to d1pwta_
    complexed with so4; mutant

Details for d3i9qa_

PDB Entry: 3i9q (more details), 1.45 Å

PDB Description: crystal structure of the triple mutant s19g-p20d-r21s of alpha spectrin sh3 domain
PDB Compounds: (A:) spectrin alpha chain

SCOPe Domain Sequences for d3i9qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i9qa_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
kelvlalydyqekgdsevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld

SCOPe Domain Coordinates for d3i9qa_:

Click to download the PDB-style file with coordinates for d3i9qa_.
(The format of our PDB-style files is described here.)

Timeline for d3i9qa_: