SCOPe 2.06: Domain d3i9lb_: 3i9l B:

Lineage for d3i9lb_ (3i9l B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
   contains extra N-terminal all-alpha subdomain
   automatically mapped to Pfam PF02267

6. Protein automated matches [191078] (1 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [189008] (12 PDB entries)

8. Domain d3i9lb_: 3i9l B: [178181]
   automated match to d1r0sa_
   complexed with n1c

Details for d3i9lb_

PDB Entry: 3i9l, 1.75 Å

PDB Description: crystal structure of adp ribosyl cyclase complexed with n1-cidpr

PDB Compounds: (B:) ADP-ribosyl cyclase

SCOPe Domain Sequences for d3i9lb_:

Sequence; same for both SEQRES and ATOM records:

>d3i9lb_ c.23.14.3 (B:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkygl
pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
dnpnarecrla

Timeline for d3i9lb_:

• d3i9lb_ first appeared in SCOPe 2.01
  
• d3i9lb_ appears in SCOPe 2.05
  
• d3i9lb_ appears in SCOPe 2.07
  
• d3i9lb_ appears in the current release, SCOPe 2.08