SCOP 1.55: Domain d1bv2__: 1bv2 -

Lineage for d1bv2__ (1bv2 -)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (3 families)

5. Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (2 proteins)

6. Protein Plant non-specific lipid-transfer protein (ns-LTP) [47703] (4 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [47707] (2 PDB entries)

8. Domain d1bv2__: 1bv2 - [17818]

Details for d1bv2__

PDB Entry: 1bv2

PDB Description: lipid transfer protein from rice seeds, nmr, 14 structures

SCOP Domain Sequences for d1bv2__:

Sequence; same for both SEQRES and ATOM records:

>d1bv2__ a.52.1.1 (-) Plant non-specific lipid-transfer protein (ns-LTP) {Rice (Oryza sativa)}
itcgqvnsavgpcltyarggagpsaaccsgvrslkaaasttadrrtacnclknaargikg
lnagnaasipskcgvsvpytisasidcsrvs

Timeline for d1bv2__:

• d1bv2__ appears in SCOP 1.57
  
• d1bv2__ appears in the current release, SCOPe 2.08, called d1bv2a_