Lineage for d1bv2a_ (1bv2 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714860Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2714861Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2714862Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)
  6. 2714870Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species)
  7. 2714892Species Rice (Oryza sativa) [TaxId:4530] [47707] (5 PDB entries)
    Uniprot P23096 26-116
  8. 2714898Domain d1bv2a_: 1bv2 A: [17818]

Details for d1bv2a_

PDB Entry: 1bv2 (more details)

PDB Description: lipid transfer protein from rice seeds, nmr, 14 structures
PDB Compounds: (A:) nonspecific lipid transfer protein

SCOPe Domain Sequences for d1bv2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bv2a_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Rice (Oryza sativa) [TaxId: 4530]}
itcgqvnsavgpcltyarggagpsaaccsgvrslkaaasttadrrtacnclknaargikg
lnagnaasipskcgvsvpytisasidcsrvs

SCOPe Domain Coordinates for d1bv2a_:

Click to download the PDB-style file with coordinates for d1bv2a_.
(The format of our PDB-style files is described here.)

Timeline for d1bv2a_: